METTL24 polyclonal antibody
  • METTL24 polyclonal antibody

METTL24 polyclonal antibody

Ref: AB-PAB23112
METTL24 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant METTL24.
Información adicional
Size 100 uL
Gene Name METTL24
Gene Alias RP1-71D21.2|C6orf186|dJ71D21.2
Gene Description methyltransferase like 24
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LEQIGQLIFEIHLHWPGFEVSGSDSSVVRFWYSLLKELEQKDFRLFHSYKDLSKPQLFLKKDIFNASSCYTLSWVNTRW
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human METTL24.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 728464
Iso type IgG

Enviar un mensaje


METTL24 polyclonal antibody

METTL24 polyclonal antibody