THAP9 polyclonal antibody
  • THAP9 polyclonal antibody

THAP9 polyclonal antibody

Ref: AB-PAB23109
THAP9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant THAP9.
Información adicional
Size 100 uL
Gene Name THAP9
Gene Alias FLJ23320|FLJ34093
Gene Description THAP domain containing 9
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LSEALLDLSDHRRNLICYAGYVANKLSALLTCEDCITALYASDLKASKIGSLLFVKKKNGLHFPSESLCRVINICERVVRTHSR
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human THAP9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79725
Iso type IgG

Enviar un mensaje


THAP9 polyclonal antibody

THAP9 polyclonal antibody