SHE polyclonal antibody
  • SHE polyclonal antibody

SHE polyclonal antibody

Ref: AB-PAB23108
SHE polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SHE.
Información adicional
Size 100 uL
Gene Name SHE
Gene Alias DKFZp451D1511|DKFZp686E14106|RP11-350G8.8
Gene Description Src homology 2 domain containing E
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PYDAQQMITEIRRRGSKDPLVKALQLLDSPCEPADGGLKSETLAKRRSSKDLLGKPPQLYDTPY
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SHE.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 126669
Iso type IgG

Enviar un mensaje


SHE polyclonal antibody

SHE polyclonal antibody