GIN1 polyclonal antibody
  • GIN1 polyclonal antibody

GIN1 polyclonal antibody

Ref: AB-PAB23107
GIN1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GIN1.
Información adicional
Size 100 uL
Gene Name GIN1
Gene Alias FLJ20125|GIN-1|TGIN1|ZH2C2
Gene Description gypsy retrotransposon integrase 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NGDLHLKQIAYYKRTGEYHSTTLPSERSGIRRAAKKFVFKEKKLFYVGKDRKQNRLVIVSEEEKKKVLRECHENDSGAHHGISRTLT
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GIN1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54826
Iso type IgG

Enviar un mensaje


GIN1 polyclonal antibody

GIN1 polyclonal antibody