SNX2 polyclonal antibody
  • SNX2 polyclonal antibody

SNX2 polyclonal antibody

Ref: AB-PAB23106
SNX2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SNX2.
Información adicional
Size 100 uL
Gene Name SNX2
Gene Alias MGC5204|TRG-9
Gene Description sorting nexin 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq ATEEVSLDSPEREPILSSEPSPAVTPVTPTTLIAPRIESKSMSAPVIFDRSREEIEEEANGDIFDIEIGVSDP
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SNX2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6643
Iso type IgG

Enviar un mensaje


SNX2 polyclonal antibody

SNX2 polyclonal antibody