GEMIN5 polyclonal antibody
  • GEMIN5 polyclonal antibody

GEMIN5 polyclonal antibody

Ref: AB-PAB23104
GEMIN5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GEMIN5.
Información adicional
Size 100 uL
Gene Name GEMIN5
Gene Alias DKFZp586M1824|MGC142174
Gene Description gem (nuclear organelle) associated protein 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq YDSGSFTIMQEVYSAFLPDGCDHLRDKLGDHQSPATPAFKSLEAFFLYGRLYEFWWSLSRPCPNSSVWVRAGHRTLSVEPSQQLDTASTEETDPET
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GEMIN5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 25929
Iso type IgG

Enviar un mensaje


GEMIN5 polyclonal antibody

GEMIN5 polyclonal antibody