NIT2 polyclonal antibody
  • NIT2 polyclonal antibody

NIT2 polyclonal antibody

Ref: AB-PAB23095
NIT2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NIT2.
Información adicional
Size 100 uL
Gene Name NIT2
Gene Alias MGC111199
Gene Description nitrilase family, member 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq YLIGGSIPEEDAGKLYNTCAVFGPDGTLLAKYRKIHLFDIDVPGKITFQESKTLSPGDSFSTFDTPYCRVGLGICYDMRFAELAQIYAQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NIT2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56954
Iso type IgG

Enviar un mensaje


NIT2 polyclonal antibody

NIT2 polyclonal antibody