RNF7 polyclonal antibody
  • RNF7 polyclonal antibody

RNF7 polyclonal antibody

Ref: AB-PAB23094
RNF7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RNF7.
Información adicional
Size 100 uL
Gene Name RNF7
Gene Alias CKBBP1|ROC2|SAG
Gene Description ring finger protein 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq SLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RNF7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9616
Iso type IgG

Enviar un mensaje


RNF7 polyclonal antibody

RNF7 polyclonal antibody