TMEM139 polyclonal antibody
  • TMEM139 polyclonal antibody

TMEM139 polyclonal antibody

Ref: AB-PAB23093
TMEM139 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM139.
Información adicional
Size 100 uL
Gene Name TMEM139
Gene Alias FLJ90586
Gene Description transmembrane protein 139
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq GLRSQLQSMQTESPGPSGNARDNEAFEVPVYEEAVVGLESQCRPQELDQPPPYSTVVIPPAPEEEQPSHP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM139.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 135932
Iso type IgG

Enviar un mensaje


TMEM139 polyclonal antibody

TMEM139 polyclonal antibody