DCLRE1A polyclonal antibody
  • DCLRE1A polyclonal antibody

DCLRE1A polyclonal antibody

Ref: AB-PAB23083
DCLRE1A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DCLRE1A.
Información adicional
Size 100 uL
Gene Name DCLRE1A
Gene Alias KIAA0086|PSO2|SNM1|SNM1A|hSNM1
Gene Description DNA cross-link repair 1A (PSO2 homolog, S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq TTPGKLCRTQKSQHVSPKIRPVYDGYCPNCQMPFSSLIGQTPRWHVFECLDSPPRSETECPDGLLCTSTIPFHYKRYTHFLLAQSRAG
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DCLRE1A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9937
Iso type IgG

Enviar un mensaje


DCLRE1A polyclonal antibody

DCLRE1A polyclonal antibody