ZC3H12D polyclonal antibody
  • ZC3H12D polyclonal antibody

ZC3H12D polyclonal antibody

Ref: AB-PAB23080
ZC3H12D polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZC3H12D.
Información adicional
Size 100 uL
Gene Name ZC3H12D
Gene Alias C6orf95|FLJ46041|MCPIP4|dJ281H8.1|p34
Gene Description zinc finger CCCH-type containing 12D
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GYDREDVLRVLGKLGEGALVNDVLQELIRTGSRPGALEHPAAPRLVPRGSCGVPDSAQRGPGTALEEDFRTLA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZC3H12D.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 340152
Iso type IgG

Enviar un mensaje


ZC3H12D polyclonal antibody

ZC3H12D polyclonal antibody