Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
ZC3H12D polyclonal antibody
Abnova
ZC3H12D polyclonal antibody
Ref: AB-PAB23080
ZC3H12D polyclonal antibody
Contáctenos
Información del producto
Rabbit polyclonal antibody raised against recombinant ZC3H12D.
Información adicional
Size
100 uL
Gene Name
ZC3H12D
Gene Alias
C6orf95|FLJ46041|MCPIP4|dJ281H8.1|p34
Gene Description
zinc finger CCCH-type containing 12D
Storage Conditions
Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key
IHC-P
Immunogen Prot. Seq
GYDREDVLRVLGKLGEGALVNDVLQELIRTGSRPGALEHPAAPRLVPRGSCGVPDSAQRGPGTALEEDFRTLA
Form
Liquid
Recomended Dilution
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species
Human
Immunogen
Recombinant protein corresponding to amino acids of human ZC3H12D.
Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID
340152
Iso type
IgG
Enviar un mensaje
ZC3H12D polyclonal antibody
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*