COPS4 polyclonal antibody
  • COPS4 polyclonal antibody

COPS4 polyclonal antibody

Ref: AB-PAB23079
COPS4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant COPS4.
Información adicional
Size 100 uL
Gene Name COPS4
Gene Alias CSN4|MGC10899|MGC15160
Gene Description COP9 constitutive photomorphogenic homolog subunit 4 (Arabidopsis)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq ALKHALHCTILASAGQQRSRMLATLFKDERCQQLAAYGILEKMYLDRIIRGNQLQEFAAMLMPHQKATTADGSSILDRAVIEHNLLSASKLY
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human COPS4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51138
Iso type IgG

Enviar un mensaje


COPS4 polyclonal antibody

COPS4 polyclonal antibody