KIAA0232 polyclonal antibody
  • KIAA0232 polyclonal antibody

KIAA0232 polyclonal antibody

Ref: AB-PAB23078
KIAA0232 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIAA0232.
Información adicional
Size 100 uL
Gene Name KIAA0232
Gene Alias -
Gene Description KIAA0232
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq YSSGVIKDIWTKMADTNSVATVEIERTDAELFSADVNNYCCCLDAEAELETLQEPDKAVRRSEYHLWEGQKESLEKRAFASSELSNVDGGDYT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIAA0232.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9778
Iso type IgG

Enviar un mensaje


KIAA0232 polyclonal antibody

KIAA0232 polyclonal antibody