COPB2 polyclonal antibody
  • COPB2 polyclonal antibody

COPB2 polyclonal antibody

Ref: AB-PAB23074
COPB2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant COPB2.
Información adicional
Size 100 uL
Gene Name COPB2
Gene Alias beta'-COP
Gene Description coatomer protein complex, subunit beta 2 (beta prime)
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq VALGYDEGSIIVKLGREEPAMSMDANGKIIWAKHSEVQQANLKAMGDAEIKDGERLPLAVKDMGSCEIYPQTIQHNPNGRFVVVCGDGEYIIYTA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human COPB2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9276
Iso type IgG

Enviar un mensaje


COPB2 polyclonal antibody

COPB2 polyclonal antibody