LOC90826 polyclonal antibody
  • LOC90826 polyclonal antibody

LOC90826 polyclonal antibody

Ref: AB-PAB23070
LOC90826 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LOC90826.
Información adicional
Size 100 uL
Gene Name LOC90826
Gene Alias FLJ46629
Gene Description hypothetical protein BC004337
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HTKSLDIEIPKHIPERVSLVVTETVDAGLFGEGIVESLIHAWEHLLLQPKTKGESANCEKYGKVIPASAVIFGMAVECAEIRRHHRVGIKDIAGIHLPT
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LOC90826.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 90826
Iso type IgG

Enviar un mensaje


LOC90826 polyclonal antibody

LOC90826 polyclonal antibody