NCAN polyclonal antibody
  • NCAN polyclonal antibody

NCAN polyclonal antibody

Ref: AB-PAB23066
NCAN polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NCAN.
Información adicional
Size 100 uL
Gene Name NCAN
Gene Alias CSPG3|FLJ44681
Gene Description neurocan
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq TDASERGLHMQKLGSGSVQAALAELVALPCLFTLQPRPSAARDAPRIKWTKVRTASGQRQDLPILVAKDNVVRVAKSWQGR
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NCAN.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1463
Iso type IgG

Enviar un mensaje


NCAN polyclonal antibody

NCAN polyclonal antibody