TEX15 polyclonal antibody
  • TEX15 polyclonal antibody

TEX15 polyclonal antibody

Ref: AB-PAB23060
TEX15 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TEX15.
Información adicional
Size 100 uL
Gene Name TEX15
Gene Alias DKFZp434M2415
Gene Description testis expressed 15
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SVYKRSMTEGSTVNTEYKNQKNQISEESCLNEKIITTNLIDSHLSTKNTTTESVPLKNTVSNPLNKREKKGEIKVSKDSQSDLTLHSEIAYISKPGILGVNHTPILPAHSETCKVPTLL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TEX15.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56154
Iso type IgG

Enviar un mensaje


TEX15 polyclonal antibody

TEX15 polyclonal antibody