NPAL1 polyclonal antibody
  • NPAL1 polyclonal antibody

NPAL1 polyclonal antibody

Ref: AB-PAB23054
NPAL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NPAL1.
Información adicional
Size 100 uL
Gene Name NPAL1
Gene Alias DKFZp686A06115
Gene Description NIPA-like domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NTDITWSELTSTAKKEAVSLNVNENNYVLLENLECSAPGYNDDVTLFSRTDD
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NPAL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 152519
Iso type IgG

Enviar un mensaje


NPAL1 polyclonal antibody

NPAL1 polyclonal antibody