EPC2 polyclonal antibody
  • EPC2 polyclonal antibody

EPC2 polyclonal antibody

Ref: AB-PAB23053
EPC2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant EPC2.
Información adicional
Size 100 uL
Gene Name EPC2
Gene Alias DKFZp566F2124|EPC-LIKE
Gene Description enhancer of polycomb homolog 2 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq YATPATLHNGNHHKVQECKTKHPHHLSLKEEASDVVRQKKKYPKKPKAEALITSQQPTPETLPVINKSDIKQYDFHSSDEDEFPQVLS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human EPC2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 26122
Iso type IgG

Enviar un mensaje


EPC2 polyclonal antibody

EPC2 polyclonal antibody