TANC1 polyclonal antibody
  • TANC1 polyclonal antibody

TANC1 polyclonal antibody

Ref: AB-PAB23051
TANC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TANC1.
Información adicional
Size 100 uL
Gene Name TANC1
Gene Alias KIAA1728|ROLSB|TANC
Gene Description tetratricopeptide repeat, ankyrin repeat and coiled-coil containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LQEGLQSKGRPVSPQSRAGIGKSLREPVAQPGLLLQPSKQAQIVKTSQHLGSGQSAVRNGSMKVQISSQNPPPSPMPGRIAATP
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TANC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 85461
Iso type IgG

Enviar un mensaje


TANC1 polyclonal antibody

TANC1 polyclonal antibody