LIN28B polyclonal antibody
  • LIN28B polyclonal antibody

LIN28B polyclonal antibody

Ref: AB-PAB23042
LIN28B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LIN28B.
Información adicional
Size 100 uL
Gene Name LIN28B
Gene Alias CSDD2|FLJ16517
Gene Description lin-28 homolog B (C. elegans)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq KKCHYCQSIMHMVANCPHKNVAQPPASSQGRQEAESQPCTSTLPREVGGGHGCTSPPFPQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LIN28B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 389421
Iso type IgG

Enviar un mensaje


LIN28B polyclonal antibody

LIN28B polyclonal antibody