ARSI polyclonal antibody
  • ARSI polyclonal antibody

ARSI polyclonal antibody

Ref: AB-PAB23040
ARSI polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ARSI.
Información adicional
Size 100 uL
Gene Name ARSI
Gene Alias FLJ16069
Gene Description arylsulfatase family, member I
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TYDNCDGPGVCGFDLHEGENVAWGLSGQYSTMLYAQRASHILASHSPQRPLFLYVAFQAVHTPLQSPREYLYRYRTMGNVA
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ARSI.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 340075
Iso type IgG

Enviar un mensaje


ARSI polyclonal antibody

ARSI polyclonal antibody