DDX21 polyclonal antibody
  • DDX21 polyclonal antibody

DDX21 polyclonal antibody

Ref: AB-PAB23032
DDX21 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DDX21.
Información adicional
Size 100 uL
Gene Name DDX21
Gene Alias DKFZp686F21172|GUA|GURDB|RH-II/GU|RH-II/GuA
Gene Description DEAD (Asp-Glu-Ala-Asp) box polypeptide 21
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq KPKSDKTEEIAEEEETVFPKAKQVKKKAEPSEVDMNSPKSKKAKKKEEPSQNDISPKTKSLRKKKEPIEKKVV
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DDX21.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9188
Iso type IgG

Enviar un mensaje


DDX21 polyclonal antibody

DDX21 polyclonal antibody