LARP5 polyclonal antibody
  • LARP5 polyclonal antibody

LARP5 polyclonal antibody

Ref: AB-PAB23028
LARP5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LARP5.
Información adicional
Size 100 uL
Gene Name LARP5
Gene Alias DKFZp686M23113|KIAA0217
Gene Description La ribonucleoprotein domain family, member 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq FENRLSSLIIGPSKERTLSADASVNTLPVVVSREPSVPASCAVSATYERSPSPAHLPDDPKVAEKQRETHSVDRLPSALTATACKSVQVN
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LARP5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23185
Iso type IgG

Enviar un mensaje


LARP5 polyclonal antibody

LARP5 polyclonal antibody