SCLT1 polyclonal antibody
  • SCLT1 polyclonal antibody

SCLT1 polyclonal antibody

Ref: AB-PAB23025
SCLT1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SCLT1.
Información adicional
Size 100 uL
Gene Name SCLT1
Gene Alias CAP1A|FLJ30655|FLJ36042|MGC70542|hCAP-1A
Gene Description sodium channel and clathrin linker 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq KTQAVELWQTVSQELDRLHKLYQEHMTEAQIHVFESQKQKDQLFDFQQLTKQLHVTNENMEVTNQQFLKTVTEQSVIIE
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SCLT1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 132320
Iso type IgG

Enviar un mensaje


SCLT1 polyclonal antibody

SCLT1 polyclonal antibody