DDX46 polyclonal antibody
  • DDX46 polyclonal antibody

DDX46 polyclonal antibody

Ref: AB-PAB23023
DDX46 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DDX46.
Información adicional
Size 100 uL
Gene Name DDX46
Gene Alias FLJ25329|KIAA0801|MGC9936|PRPF5
Gene Description DEAD (Asp-Glu-Ala-Asp) box polypeptide 46
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq KEGNEMEGEELDPLDAYMEEVKEEVKKFNMRSVKGGGGNEKKSGPTVTKVVTVVTTKKAVVDSDKKKGELMENDQDAM
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DDX46.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9879
Iso type IgG

Enviar un mensaje


DDX46 polyclonal antibody

DDX46 polyclonal antibody