HIBCH polyclonal antibody
  • HIBCH polyclonal antibody

HIBCH polyclonal antibody

Ref: AB-PAB23021
HIBCH polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HIBCH.
Información adicional
Size 100 uL
Gene Name HIBCH
Gene Alias HIBYL-COA-H
Gene Description 3-hydroxyisobutyryl-Coenzyme A hydrolase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq PRLQGKLGYFLALTGFRLKGRDVYRAGIATHFVDSEKLAMLEEDLLALKSPSKENIASVLENYHTESKIDRDKSFILEEHMDKINSCFSANTVEEI
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HIBCH.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 26275
Iso type IgG

Enviar un mensaje


HIBCH polyclonal antibody

HIBCH polyclonal antibody