CCNJ polyclonal antibody
  • CCNJ polyclonal antibody

CCNJ polyclonal antibody

Ref: AB-PAB23020
CCNJ polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCNJ.
Información adicional
Size 100 uL
Gene Name CCNJ
Gene Alias bA690P14.1
Gene Description cyclin J
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq TRLHRLTAYSWDFLVQCIERLLIAHDNDVKEANKQRGQAGPQSAQLSVFQTASQPSRPVHFQQPQYLHQTHQTSLQYRHPT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CCNJ.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54619
Iso type IgG

Enviar un mensaje


CCNJ polyclonal antibody

CCNJ polyclonal antibody