RWDD4A polyclonal antibody
  • RWDD4A polyclonal antibody

RWDD4A polyclonal antibody

Ref: AB-PAB23015
RWDD4A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RWDD4A.
Información adicional
Size 100 uL
Gene Name RWDD4A
Gene Alias FAM28A|MGC10198
Gene Description RWD domain containing 4A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq EALRSIYEGDESFRELSPVSFQYRIGENGDPKAFLIEISWTETYPQTPPILSMNAFFNNTISSAVKQSILAKLQEAVEANLGTAM
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RWDD4A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 201965
Iso type IgG

Enviar un mensaje


RWDD4A polyclonal antibody

RWDD4A polyclonal antibody