KY polyclonal antibody
  • KY polyclonal antibody

KY polyclonal antibody

Ref: AB-PAB23013
KY polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KY.
Información adicional
Size 100 uL
Gene Name KY
Gene Alias FLJ33207
Gene Description kyphoscoliosis peptidase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AQGTLSDQQANPSSLLQRGGGFQGVGNGVRRWQKLEGNDFHENLVEKQHPQQPQVITSYNSQGTQLTVEVHPRDAMPQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KY.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 339855
Iso type IgG

Enviar un mensaje


KY polyclonal antibody

KY polyclonal antibody