ARSJ polyclonal antibody
  • ARSJ polyclonal antibody

ARSJ polyclonal antibody

Ref: AB-PAB23010
ARSJ polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ARSJ.
Información adicional
Size 100 uL
Gene Name ARSJ
Gene Alias FLJ23548
Gene Description arylsulfatase family, member J
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DSPGMCGYDLYENDNAAWDYDNGIYSTQMYTQRVQQILASHNPTKPIFLYIAYQAVHSPLQAPGRYFEHYRSIININRRRYAAMLSCLDEAINNV
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ARSJ.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79642
Iso type IgG

Enviar un mensaje


ARSJ polyclonal antibody

ARSJ polyclonal antibody