SH3PXD2B polyclonal antibody
  • SH3PXD2B polyclonal antibody

SH3PXD2B polyclonal antibody

Ref: AB-PAB23008
SH3PXD2B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SH3PXD2B.
Información adicional
Size 100 uL
Gene Name SH3PXD2B
Gene Alias FAD49|FLJ20831|HOFI|KIAA1295
Gene Description SH3 and PX domains 2B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq PPGVILPMMPAKHIPPARDSRRPEPKPDKSRLFQLKNDMGLECGHKVLAKEVKKPNLRPISKSKTDLPEEKPDATPQNPFLKSRPQV
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SH3PXD2B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 285590
Iso type IgG

Enviar un mensaje


SH3PXD2B polyclonal antibody

SH3PXD2B polyclonal antibody