FAM53A polyclonal antibody
  • FAM53A polyclonal antibody

FAM53A polyclonal antibody

Ref: AB-PAB23004
FAM53A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM53A.
Información adicional
Size 100 uL
Gene Name FAM53A
Gene Alias DNTNP
Gene Description family with sequence similarity 53, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq LDDLTCKAEAGPLQYSAETLNKSGRLFPLELNDQSPWKVFSGGPPVRSQAATGPDFSFLPGLSAAAHTMGLQWQPQSPRPGAGLGAASTVDPSEST
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM53A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 152877
Iso type IgG

Enviar un mensaje


FAM53A polyclonal antibody

FAM53A polyclonal antibody