LRPPRC polyclonal antibody
  • LRPPRC polyclonal antibody

LRPPRC polyclonal antibody

Ref: AB-PAB22998
LRPPRC polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LRPPRC.
Información adicional
Size 100 uL
Gene Name LRPPRC
Gene Alias CLONE-23970|GP130|LRP130|LSFC
Gene Description leucine-rich PPR-motif containing
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq RIWDTLQKLGAVYDVSHYNALLKVYLQNEYKFSPTDFLAKMEEANIQPNRVTYQRLIASYCNVGDIEGASKILGFMKTKDLPVT
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LRPPRC.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10128
Iso type IgG

Enviar un mensaje


LRPPRC polyclonal antibody

LRPPRC polyclonal antibody