OBSL1 polyclonal antibody
  • OBSL1 polyclonal antibody

OBSL1 polyclonal antibody

Ref: AB-PAB22997
OBSL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant OBSL1.
Información adicional
Size 100 uL
Gene Name OBSL1
Gene Alias KIAA0657|MGC71026
Gene Description obscurin-like 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq NAVLLVETLEAGVEGRWSRDGEELPVICQSSSGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKP
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human OBSL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23363
Iso type IgG

Enviar un mensaje


OBSL1 polyclonal antibody

OBSL1 polyclonal antibody