LACTB polyclonal antibody
  • LACTB polyclonal antibody

LACTB polyclonal antibody

Ref: AB-PAB22989
LACTB polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LACTB.
Información adicional
Size 100 uL
Gene Name LACTB
Gene Alias FLJ14902|G24|MRPL56
Gene Description lactamase, beta
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NSNENLLPGYLKPETMVMMWTPVPNTEMSWDKEGKYAMAWGVVEKKQTYGSCRKQRHYASHTGGAVGASSVLLVLPEELDTETINNKVP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LACTB.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 114294
Iso type IgG

Enviar un mensaje


LACTB polyclonal antibody

LACTB polyclonal antibody