KIAA1244 polyclonal antibody
  • KIAA1244 polyclonal antibody

KIAA1244 polyclonal antibody

Ref: AB-PAB22986
KIAA1244 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIAA1244.
Información adicional
Size 100 uL
Gene Name KIAA1244
Gene Alias C6orf192|C6orf92|RP3-422G23.4|big3|dJ171N11.1|dJ55C23.6
Gene Description KIAA1244
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq SLKLLKNQEADQHSARLFIQSLEGLLPRLLSLSNVEEVDTALQNFASTFCSGMMHSPGFDGNSSLSFQMLMNADSLYTAAHCALLLNLKLSHG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIAA1244.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57221
Iso type IgG

Enviar un mensaje


KIAA1244 polyclonal antibody

KIAA1244 polyclonal antibody