TTC26 polyclonal antibody
  • TTC26 polyclonal antibody

TTC26 polyclonal antibody

Ref: AB-PAB22983
TTC26 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TTC26.
Información adicional
Size 100 uL
Gene Name TTC26
Gene Alias FLJ12571|MGC163211|dyf-13
Gene Description tetratricopeptide repeat domain 26
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GVQHTDKRKKKGRKIPKLEELLSKRDFTGAITLLEFKRHVGEEEEDTNLWIGYCAFHLGDYKRALEEYENATKEENCNSEVWVNLACTYFFLGMYKQAEAAGFKASKSRLQNRLLFHLAH
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TTC26.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79989
Iso type IgG

Enviar un mensaje


TTC26 polyclonal antibody

TTC26 polyclonal antibody