UBXN4 polyclonal antibody
  • UBXN4 polyclonal antibody

UBXN4 polyclonal antibody

Ref: AB-PAB22981
UBXN4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant UBXN4.
Información adicional
Size 100 uL
Gene Name UBXN4
Gene Alias FLJ23318|KIAA0242|KIAA2042|UBXD2|UBXDC1|erasin
Gene Description UBX domain protein 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq ERSTVARIQFRLPDGSSFTNQFPSDAPLEEARQFAAQTVGNTYGNFSLATMFPRREFTKEDYKKKLLDLELAPSASVVLLPAGRPTASIV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human UBXN4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23190
Iso type IgG

Enviar un mensaje


UBXN4 polyclonal antibody

UBXN4 polyclonal antibody