EXOC6 polyclonal antibody
  • EXOC6 polyclonal antibody

EXOC6 polyclonal antibody

Ref: AB-PAB22976
EXOC6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant EXOC6.
Información adicional
Size 100 uL
Gene Name EXOC6
Gene Alias DKFZp761I2124|EXOC6A|FLJ1125|FLJ11251|MGC33397|SEC15|SEC15L|SEC15L1|SEC15L3|Sec15p
Gene Description exocyst complex component 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq TFSVSLQKQNKMKFGKNMYINRDRIPEERNETVLKHSLEEE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human EXOC6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54536
Iso type IgG

Enviar un mensaje


EXOC6 polyclonal antibody

EXOC6 polyclonal antibody