NAF1 polyclonal antibody
  • NAF1 polyclonal antibody

NAF1 polyclonal antibody

Ref: AB-PAB22969
NAF1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NAF1.
Información adicional
Size 100 uL
Gene Name NAF1
Gene Alias -
Gene Description nuclear assembly factor 1 homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EIFGPVAHPFYVLRFNSSDHIESKGIKIKETMYFAPSMKDFTQYIFTEKLKQDKGSDASWKNDQEPPPEALDFSDDEKEKEAKQRKKSQIQGRK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NAF1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 92345
Iso type IgG

Enviar un mensaje


NAF1 polyclonal antibody

NAF1 polyclonal antibody