PLCH1 polyclonal antibody
  • PLCH1 polyclonal antibody

PLCH1 polyclonal antibody

Ref: AB-PAB22962
PLCH1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PLCH1.
Información adicional
Size 100 uL
Gene Name PLCH1
Gene Alias DKFZp434C1372|MGC117152|PLCL3|PLCeta1
Gene Description phospholipase C, eta 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq SLTTCEYRREGTSQLASPLKLKYNQGVVEHFQRGLRNGYCKETLRPSVPEIFNNIQDVKTQSISYLAYQGAGFVHNHFSDSDAKMFQTCVPQQS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PLCH1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23007
Iso type IgG

Enviar un mensaje


PLCH1 polyclonal antibody

PLCH1 polyclonal antibody