DHX57 polyclonal antibody
  • DHX57 polyclonal antibody

DHX57 polyclonal antibody

Ref: AB-PAB22957
DHX57 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DHX57.
Información adicional
Size 100 uL
Gene Name DHX57
Gene Alias DDX57|FLJ32861
Gene Description DEAH (Asp-Glu-Ala-Asp/His) box polypeptide 57
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KRQFTELLSDIGFAREGLRAREIEKRAQGGDGVLDATGEEANSNAENPKLISAMLCAALYPNVVQVKSPEGKFQKTSTGAVR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DHX57.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 90957
Iso type IgG

Enviar un mensaje


DHX57 polyclonal antibody

DHX57 polyclonal antibody