FAM110C polyclonal antibody
  • FAM110C polyclonal antibody

FAM110C polyclonal antibody

Ref: AB-PAB22953
FAM110C polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM110C.
Información adicional
Size 100 uL
Gene Name FAM110C
Gene Alias -
Gene Description family with sequence similarity 110, member C
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq IYRQKCEFVRGSGADGPRASLVKKLFQGPGKDKAPVPRTGDEGKAGNPETV
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM110C.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 642273
Iso type IgG

Enviar un mensaje


FAM110C polyclonal antibody

FAM110C polyclonal antibody