AMTN polyclonal antibody
  • AMTN polyclonal antibody

AMTN polyclonal antibody

Ref: AB-PAB22952
AMTN polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant AMTN.
Información adicional
Size 100 uL
Gene Name AMTN
Gene Alias MGC148132|MGC148133|UNQ689
Gene Description amelotin
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SLPQLKPALGLPPTKLAPDQGTLPNQQQSNQVFPSLSLIPLTQMLTLGPDLHLLNPAAGMTPGTQTHPLTLGGLNVQQQLHPHVLPIFVTQLGAQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human AMTN.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 401138
Iso type IgG

Enviar un mensaje


AMTN polyclonal antibody

AMTN polyclonal antibody