C1orf14 polyclonal antibody
  • C1orf14 polyclonal antibody

C1orf14 polyclonal antibody

Ref: AB-PAB22949
C1orf14 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C1orf14.
Información adicional
Size 100 uL
Gene Name C1orf14
Gene Alias GE36|MGC26911|MGC48296|SHCBP1L
Gene Description chromosome 1 open reading frame 14
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FPGEYQAANLALLTDDIIIKGVGKREEIMITSEPSRDSFVVSKADNVKLMHLSLIQQGTVDGIVVVESGHMTLENCILKCEGTGVC
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C1orf14.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 81626
Iso type IgG

Enviar un mensaje


C1orf14 polyclonal antibody

C1orf14 polyclonal antibody