ASCL4 polyclonal antibody
  • ASCL4 polyclonal antibody

ASCL4 polyclonal antibody

Ref: AB-PAB22948
ASCL4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ASCL4.
Información adicional
Size 100 uL
Gene Name ASCL4
Gene Alias HASH4|bHLHa44
Gene Description achaete-scute complex homolog 4 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq METRKPAERLALPYSLRTAPLGVPGTLPGLPRRDPLRVALRLDAACWEWARSGCARGWQYLPVPLDSAFEPAF
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ASCL4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 121549
Iso type IgG

Enviar un mensaje


ASCL4 polyclonal antibody

ASCL4 polyclonal antibody