ALG1L polyclonal antibody
  • ALG1L polyclonal antibody

ALG1L polyclonal antibody

Ref: AB-PAB22946
ALG1L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ALG1L.
Información adicional
Size 100 uL
Gene Name ALG1L
Gene Alias -
Gene Description beta-1,4-mannosyltransferase-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VLPLVMDIQLLGQRLKPRDPCCPSRSFFSESQGKPF
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ALG1L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 200810
Iso type IgG

Enviar un mensaje


ALG1L polyclonal antibody

ALG1L polyclonal antibody