LMOD3 polyclonal antibody
  • LMOD3 polyclonal antibody

LMOD3 polyclonal antibody

Ref: AB-PAB22940
LMOD3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LMOD3.
Información adicional
Size 100 uL
Gene Name LMOD3
Gene Alias DKFZp313F0135
Gene Description leiomodin 3 (fetal)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq VTDKAFKEQRDRPEAQEQSEKKISKLDPKKLALDTSFLKVSTRPSGNQTDLDGSLRRVRKNDPDMKELNLNNIENIPKEMLLDFVNAMKK
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LMOD3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56203
Iso type IgG

Enviar un mensaje


LMOD3 polyclonal antibody

LMOD3 polyclonal antibody