FEZ2 polyclonal antibody
  • FEZ2 polyclonal antibody

FEZ2 polyclonal antibody

Ref: AB-PAB22936
FEZ2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FEZ2.
Información adicional
Size 100 uL
Gene Name FEZ2
Gene Alias HUM3CL|MGC117372
Gene Description fasciculation and elongation protein zeta 2 (zygin II)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq GSYEERVKRLSVSELNEILEEIETAIKEYSEELVQQLALRDELEFEKEVKNSFISVLIEVQNKQKEHKETAKKKKKLKNGSSQNGKNERSHMPGTYLTTVIPYEKKNGPPSVEDLQILTKILRAMKEDSEKVPSLLTDYIL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FEZ2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9637
Iso type IgG

Enviar un mensaje


FEZ2 polyclonal antibody

FEZ2 polyclonal antibody